GTX14067 RGS11 antibody
see related secondary antibodiessee all 14 RGS11 products
50 µg / no delivery possible
Quick Overview
Chicken anti RGS11
Synonyms
Regulator of G-protein signaling 11, ,
Product review
Please read our product review about RGS11: Regulators of G-Protein Signaling.
Product Description
Chicken anti RGS11 , Presentation: Aff - Purified. Product is tested for Western blot / Immunoblot ( WB )
Properties
| Applications | Western blot / Immunoblot ( WB ) |
| Reactivity | Human ( Hu ), Mouse ( Ms ), Rat ( Rt ) |
| Presentation | Aff - Purified |
| Host | Chicken |
| Catalog Number | GTX14067 |
| Swiss Prot. No. | O94810 |
| Quantity | 50 µg |
| Price | no delivery possible |
| Delivery | Europe only |
| Manufacturer | GeneTex Inc. |
| Datasheet |  http://www.genetex.com/co ... |
Datasheet Extract
| RGS11 antibody | |
| Concentration | 1 mg/ml |
| Background | The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal transducing G proteins. RGS11 has a G protein beta 5 subunit binding site. The RGS11 protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP bound form. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
| Immunogen | Synthetic peptide: FLKSDMYKALLAEAGIPLEMKRRVFPFTWRPRHSSPSPA, corresponding to amino acids 408-446 of Human RGS11. Swiss Num.: O94810 |
| Format | State: Liquid Purification: Affinity purified with antigen Purity: Affinity purified with antigen BufferSystem: PBS, no preservatives added |
| Applications | WB |
| Specificity | Human, mouse, rat - Not yet tested in other species |
| Storage | Keep as concentrated solution. Store at 4 |
11 Secondary Antibodies
| Catalog No. | Name / Host | Presentation | Reactivity | ||||
|---|---|---|---|---|---|---|---|
| R1300B | Chicken IgG (H&L) | ||||||
| Rabbit | Biotin | 1.5 mg / US$ 335 | |||||
| R1300F | Chicken IgG (H&L) | ||||||
| Rabbit | FITC | 1.5 mg / US$ 305 | |||||
| R1300T | Chicken IgG (H&L) | ||||||
| Rabbit | TRITC | 1.5 mg / US$ 315 | |||||
| R1300TR | Chicken IgG (H&L) | ||||||
| Rabbit | Texas Red | 1.5 mg / US$ 345 | |||||
| R1300HRP | Chicken IgG (H&L) | ||||||
| Rabbit | HRP | 1.5 mg / US$ 325 | |||||
| R1300AP | Chicken IgG (H&L) | ||||||
| Rabbit | AP | 1 mg / US$ 365 | |||||
| R1434C2 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy2 | 1 mg / US$ 455 | |||||
| R1434C3 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3 | 1 mg / US$ 455 | |||||
| R1434C35 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3.5 | 1 mg / US$ 455 | |||||
| R1434C5 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5 | 1 mg / US$ 455 | |||||
| R1434C55 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5.5 | 1 mg / US$ 455 | |||||
Click here to see all secondary antibodies for 'GTX14067 RGS11'.
