GTX14230 Rho GDP-dissociation inhibitor 2 antibody
see related secondary antibodiessee all 35 Rho GDP-dissociation inhibitor 2 products
50 µg / no delivery possible
Quick Overview
Chicken anti Rho GDP-dissociation inhibitor 2
Synonyms
D4-GDI, D4GDI, ARHGDIB, GDIA2, GDID4, RAP1GN1, Ly-GDI, LyGDI, Rho-GDI beta, RhoGDI beta, Rho GDI 2, RhoGDI 2, RhoGDI-2, GDIA-2, GDID-4,
Product Description
Chicken anti Rho GDP-dissociation inhibitor 2 , Presentation: Aff - Purified. Product is tested for Western blot / Immunoblot ( WB )
Properties
| Applications | Western blot / Immunoblot ( WB ) |
| Reactivity | Human ( Hu ), Mouse ( Ms ), Rat ( Rt ) |
| Presentation | Aff - Purified |
| Host | Chicken |
| Catalog Number | GTX14230 |
| Swiss Prot. No. | P52566 |
| Quantity | 50 µg |
| Price | no delivery possible |
| Delivery | Europe only |
| Manufacturer | GeneTex Inc. |
| Datasheet |  http://www.genetex.com/co ... |
Datasheet Extract
| D4 GDI antibody | |
| Background | D4 GDI belongs to the family of Rho GDIs or GDP dissociation inhibitors for the Rho/Rac family of small G proteins; consisting of RhoGDI 1, D4 GDI/RhoGDI2 and Rho GDI3. It inhibits the release of GDP from the Rho proteins, essential for GTP loading and activation of GTPase activity. D4 GDI is located in the cytoplasm and in involved in the regulation of the membrane association and dissociation cycle of Rho/Rac proteins. It is known to be a substrate for caspase 3 during Fas mediated apoptosis. |
| Immunogen | Synthetic peptide: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDP , corresponding to amino acids 1-62 of Human D4 GDI. Swiss Num.: P52566 |
| Format | State: Liquid Purification: Affinity purified with antigen Purity: Affinity purified with antigen BufferSystem: PBS, no preservatives added |
| Applications | WB |
| Specificity | Human, mouse, rat and cow - Not tested in other species |
| Storage | Keep as concentrated solution. Store at 4 |
11 Secondary Antibodies
| Catalog No. | Name / Host | Presentation | Reactivity | ||||
|---|---|---|---|---|---|---|---|
| R1300B | Chicken IgG (H&L) | ||||||
| Rabbit | Biotin | 1.5 mg / US$ 325 | |||||
| R1300F | Chicken IgG (H&L) | ||||||
| Rabbit | FITC | 1.5 mg / US$ 295 | |||||
| R1300T | Chicken IgG (H&L) | ||||||
| Rabbit | TRITC | 1.5 mg / US$ 305 | |||||
| R1300TR | Chicken IgG (H&L) | ||||||
| Rabbit | Texas Red | 1.5 mg / US$ 335 | |||||
| R1300HRP | Chicken IgG (H&L) | ||||||
| Rabbit | HRP | 1.5 mg / US$ 315 | |||||
| R1300AP | Chicken IgG (H&L) | ||||||
| Rabbit | AP | 1 mg / US$ 355 | |||||
| R1434C2 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy2 | 1 mg / US$ 445 | |||||
| R1434C3 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3 | 1 mg / US$ 445 | |||||
| R1434C35 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3.5 | 1 mg / US$ 445 | |||||
| R1434C5 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5 | 1 mg / US$ 445 | |||||
| R1434C55 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5.5 | 1 mg / US$ 445 | |||||
Click here to see all secondary antibodies for 'GTX14230 Rho GDP-dissociation inhibitor 2 '.