GTX19109 Macrophage Inflammatory Protein 1 beta antibody
see related secondary antibodiessee all 7 Macrophage Inflammatory Protein 1 beta products
50 µg / no delivery possible
Quick Overview
Chicken anti Macrophage Inflammatory Protein 1 beta
Product Description
Chicken anti Macrophage Inflammatory Protein 1 beta , Presentation: Aff - Purified. Product is tested for Enzyme Immunoassay ( E ), Western blot / Immunoblot ( WB )
Properties
| Applications | Enzyme Immunoassay ( E ), Western blot / Immunoblot ( WB ) |
| Reactivity | Human ( Hu ) |
| Presentation | Aff - Purified |
| Host | Chicken |
| Catalog Number | GTX19109 |
| Quantity | 50 µg |
| Price | no delivery possible |
| Delivery | Europe only |
| Manufacturer | GeneTex Inc. |
| Datasheet |  http://www.genetex.com/co ... |
Datasheet Extract
| Macrophage Inflammatory Protein 1 beta antibody | |
| Concentration | 1 mg/ml |
| Background | MIP1 alpha and MIP1 beta were originally co-purified from medium conditioned by an LPS-stimulated murine macrophage cell line. Human MIP1 beta refers to the products of several independently cloned cDNAs, including Act2, PAT 744, hH400, G26, HIMAP, HC21, and MAD 5a. The predicted protein products of these cDNAs represent variants that are between 94% - 98% identical and these proteins are all approximately 75% homologous to murine MIP1 beta. MIP1 beta also shares approximately 70% amino acid identity with MIP1 alpha. MIP1 proteins are expressed primarily in T cells, B cells, and monocytes after antigen or mitogen stimulation. The MIP1 proteins have chemoattractant and adhesive effects on lymphocytes, with MIP1 alpha and MIP1 beta preferentially attracting CD8+ and CD4+ T cells, respectively. A signal transducing receptor designated the CC chemokine receptor 1 (CC CKR1) with seven transmembrane domains that binds MIP1 alpha, MIP1 beta, MCP1 and RANTES with varying affinities has been isolated. |
| Immunogen | Synthetic peptide: GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta. |
| Format | State: Liquid Purification: Affinity purified with antigen Purity: Affinity purified with antigen BufferSystem: PBS, no preservatives added |
| Applications | ELISA, WB |
| Specificity | Human - Not yet tested in other species |
| Storage | Keep as concentrated solution. Store at 4 |
11 Secondary Antibodies
| Catalog No. | Name / Host | Presentation | Reactivity | ||||
|---|---|---|---|---|---|---|---|
| R1300B | Chicken IgG (H&L) | ||||||
| Rabbit | Biotin | 1.5 mg / US$ 325 | |||||
| R1300F | Chicken IgG (H&L) | ||||||
| Rabbit | FITC | 1.5 mg / US$ 295 | |||||
| R1300T | Chicken IgG (H&L) | ||||||
| Rabbit | TRITC | 1.5 mg / US$ 305 | |||||
| R1300TR | Chicken IgG (H&L) | ||||||
| Rabbit | Texas Red | 1.5 mg / US$ 335 | |||||
| R1300HRP | Chicken IgG (H&L) | ||||||
| Rabbit | HRP | 1.5 mg / US$ 315 | |||||
| R1300AP | Chicken IgG (H&L) | ||||||
| Rabbit | AP | 1 mg / US$ 355 | |||||
| R1434C2 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy2 | 1 mg / US$ 445 | |||||
| R1434C3 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3 | 1 mg / US$ 445 | |||||
| R1434C35 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3.5 | 1 mg / US$ 445 | |||||
| R1434C5 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5 | 1 mg / US$ 445 | |||||
| R1434C55 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5.5 | 1 mg / US$ 445 | |||||
Click here to see all secondary antibodies for 'GTX19109 Macrophage Inflammatory Protein 1 beta'.
