NB120-19109 Macrophage Inflammatory Protein 1 beta antibody
see related secondary antibodiessee all 7 Macrophage Inflammatory Protein 1 beta products
0.05 mg / US$ 485 no delivery possible
Quick Overview
Chicken anti Macrophage Inflammatory Protein 1 beta
Synonyms
anti-ACT2 antibody, anti-CCL4 antibody, anti-ccl4l 1 antibody , anti-CCL4L1 antibody, anti-Chemokine CC Motif Ligand 4 antibody , anti-G 26 T lymphocyte secreted protein antibody, anti-HC21 antibody, anti-lag 1 antibody, anti-LAG1 antibody, anti-Lymphocyte activation gene 1 antibody, anti-MIP1 beta antibody, anti-Small inducible cytokine A4 antibody,
Product Description
Chicken anti Macrophage Inflammatory Protein 1 beta , Presentation: Aff - Purified. Product is tested for Enzyme Immunoassay ( E ), Western blot / Immunoblot ( WB )
Properties
| Applications | Enzyme Immunoassay ( E ), Western blot / Immunoblot ( WB ) |
| Presentation | Aff - Purified |
| Host | Chicken |
| Catalog Number | NB120-19109 |
| Quantity | 0.05 mg |
| Price | US$ 485 no delivery possible |
| Delivery | Not USA/Canada |
| Manufacturer | Novus Biologicals Inc. |
| Datasheet |  http://www.novusbio.com/d ... |
Datasheet Extract
| Chicken Polyclonal anti-Macrophage Inflammatory Protein 1 beta | |
| Concentration | 1 mg/ml |
| Immunogen | Synthetic peptide: GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta. |
| Format | Purification: Immunogen affinity purified Purity: Immunogen affinity purified BufferSystem: Preservative: NoneConstituents: PBS |
| Applications | ELISA, WB |
| Specificity | Species: Cross-reacts with Human.Not yet tested in other species. |
| References | General / background references:Cocchi F et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science 270:1811-5 (1995). |
11 Secondary Antibodies
| Catalog No. | Name / Host | Presentation | Reactivity | ||||
|---|---|---|---|---|---|---|---|
| R1300B | Chicken IgG (H&L) | ||||||
| Rabbit | Biotin | 1.5 mg / US$ 325 | |||||
| R1300F | Chicken IgG (H&L) | ||||||
| Rabbit | FITC | 1.5 mg / US$ 295 | |||||
| R1300T | Chicken IgG (H&L) | ||||||
| Rabbit | TRITC | 1.5 mg / US$ 305 | |||||
| R1300TR | Chicken IgG (H&L) | ||||||
| Rabbit | Texas Red | 1.5 mg / US$ 335 | |||||
| R1300HRP | Chicken IgG (H&L) | ||||||
| Rabbit | HRP | 1.5 mg / US$ 315 | |||||
| R1300AP | Chicken IgG (H&L) | ||||||
| Rabbit | AP | 1 mg / US$ 355 | |||||
| R1434C2 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy2 | 1 mg / US$ 445 | |||||
| R1434C3 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3 | 1 mg / US$ 445 | |||||
| R1434C35 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3.5 | 1 mg / US$ 445 | |||||
| R1434C5 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5 | 1 mg / US$ 445 | |||||
| R1434C55 | Chicken IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5.5 | 1 mg / US$ 445 | |||||
Click here to see all secondary antibodies for 'NB120-19109 Macrophage Inflammatory Protein 1 beta'.
