Human Brain Natriuretic Peptide (BNP) PA1008 - antibody, protein, elisa from Acris Antibodies ...

No staining picture available ...

see all 59 Brain Natriuretic Peptide products

2 µg / US$ 225

NOVUS BIOLOGICALS
PO Box 802 Littleton, CO 80160, USA
E-Mail: novus@novus-biologicals.com
Homepage: http://www.novus-biologicals.com

Human Brain Natriuretic Peptide (BNP)

NPPB, proBNP,

Human Brain Natriuretic Peptide (BNP)


Alternate names	NPPB, Natriuretic Peptide Precursor B, BNP
Background	Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Immunogen	*Swiss Num.:* P16860
Source	Escherichia coli
Format	*State:* Lyphilized purified protein (sterile filtered) *Purity:* Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. *BufferSystem:* 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride *Reconstitution:* Restore in sterile 18Mohm-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions.
Description	Recombinant Human B-type Natriuretic Peptide produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids. NPPB is purified by proprietary chromatographic techniques. *AASequence:* SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH *Molecular weight:* 3464 kDa
Storage	Prior to reconstitution stable at RT for 3 weeks. Following reconstitution store the protein undiluted at 2-8°C for one week or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Shelf life: one year from despatch.


Phrase Exact Advanced