H00002810-M06 14-3-3 protein sigma / SFN antibody

See related secondary antibodies

Search for all "14-3-3 protein sigma / SFN"

0.1 mg / €340.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human 14-3-3 protein sigma / SFN 1E7

H00002810-M06

More Views

  • H00002810-M06

Product Description for 14-3-3 protein sigma / SFN

Mouse anti Human 14-3-3 protein sigma / SFN 1E7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for 14-3-3 protein sigma / SFN

Product Category Antibodies
Target Category
Quantity 0.1 mg
Synonyms Epithelial cell marker protein 1, HME1, Stratifin
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1E7
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
P31947
Immunogen:
SFN (AAH00329, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEE KGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQ EAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT LWTADNAGEEGGEAPQEPQS*
Genename:
2810
Remarks:
Gene Accession: BC000329
Antibody type Ab
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full-length recombinant SFN.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2810

Accessory Products

Proteins and/or Positive Controls

Proteins for 14-3-3 protein sigma / SFN (7 products)

Catalog No. Species Pres. Purity   Source  
AR09318PU-L

14-3-3 protein sigma / SFN (1-248)

Recombinant human 14-3-3 sigma, 1- 248 aa: 15% SDS-PAGE (3 µg) Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €670.00
  Acris Antibodies GmbH
AR09318PU-N

14-3-3 protein sigma / SFN (1-248)

Recombinant human 14-3-3 sigma, 1- 248 aa: 15% SDS-PAGE (3 µg) Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €250.00
  Acris Antibodies GmbH
NBP1-30172

14-3-3 protein sigma / SFN

Wetern Blot: 14-3-3 sigma/Stratifin Protein [NBP1-30172] - 15% SDS-PAGE (3ug)
0.1 mg / €310.00
  Novus Biologicals Inc.
H00002810-P01-10

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
10 µg / €350.00
  Abnova Taiwan Corp.
H00002810-P01-25

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
25 µg / €500.00
  Abnova Taiwan Corp.
H00002810-Q01-10

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €350.00
  Abnova Taiwan Corp.
H00002810-Q01-25

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for 14-3-3 protein sigma / SFN (1 products)

Catalog No. Species Pres. Purity   Source  
NBL1-15882

14-3-3 sigma Lysate

Western Blot: 14-3-3 sigma/Stratifin  Lysate [NBL1-15882] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SFN
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn