NBP1-56295 17-beta-HSD1 / HSD17B1 antibody

See related secondary antibodies

Search for all "17-beta-HSD1 / HSD17B1"

50 µg / €390.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse 17-beta-HSD1 / HSD17B1

Product Description for 17-beta-HSD1 / HSD17B1

Rabbit anti Human, Mouse 17-beta-HSD1 / HSD17B1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for 17-beta-HSD1 / HSD17B1

Product Category Antibodies
Quantity 50 µg
Synonyms 17-beta-hydroxysteroid dehydrogenase type 1, 17E2DH, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha HSD, E17KSR, EDH17B1, EDH17B2, EDHB17, Estradiol 17-beta-dehydrogenase 1, Placental 17-beta-hydroxysteroid dehydrogenase
Presentation Aff - Purified
Reactivity Hu, Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14061
Immunogen:
Synthetic peptides corresponding to HSD17B1(hydroxysteroid (17-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of HSD17B1. Peptide sequence MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA.
Genename:
3292
Antibody type Ab
Application P, WB
Background HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3292
Targets

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta-HSD1 / HSD17B1 (2 products)

Catalog No. Species Pres. Purity   Source  
H00003292-Q01-10

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human in vitro transl.
10 µg / €350.00
  Abnova Taiwan Corp.
H00003292-Q01-25

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human in vitro transl.
25 µg / €500.00
  Abnova Taiwan Corp.