NBP1-56863 17-beta HSD14 / HSD17B14 antibody

See related secondary antibodies

Search for all "17-beta HSD14 / HSD17B14"

50 µg / €390.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human 17-beta HSD14 / HSD17B14

Product Description for 17-beta HSD14 / HSD17B14

Rabbit anti Human 17-beta HSD14 / HSD17B14.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for 17-beta HSD14 / HSD17B14

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 17-beta-hydroxysteroid dehydrogenase 14, 17-beta-hydroxysteroid dehydrogenase DHRS10, DHRS10, Dehydrogenase/reductase SDR family member 10, Retinal short-chain dehydrogenase/reductase retSDR3, SDR3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the N terminal of HSD17B14. Peptide sequence RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD.
Background 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 51171

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta HSD14 / HSD17B14 (6 products)

Catalog No. Species Pres. Purity   Source  

17-beta HSD14 / HSD17B14 (1-270, His-tag)

Recombinant human HSD17B14, 1-270aa, His-tagged
Human Purified > 95 % E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

17-beta HSD14 / HSD17B14 (1-270, His-tag)

Recombinant human HSD17B14, 1-270aa, His-tagged
Human Purified > 95 % E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified
0.1 mg / €340.00
  Novus Biologicals Inc.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified
0.5 mg / €740.00
  Novus Biologicals Inc.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €350.00
  Abnova Taiwan Corp.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for 17-beta HSD14 / HSD17B14 (1 products)

Catalog No. Species Pres. Purity   Source  

DHRS10 293T Cell Transient Overexpression Lysate(Denatured)

DHRS10 293T Cell Transient Overexpression Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
  • Pinterest
  • LinkedIn