H00003283-D01P 3-beta-HSD1 / HSD3B1 antibody

See related secondary antibodies

Search for all "3-beta-HSD1 / HSD3B1"

0.1 mg / €360.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human 3-beta-HSD1 / HSD3B1

Product Description for 3-beta-HSD1 / HSD3B1

Rabbit anti Human 3-beta-HSD1 / HSD3B1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for 3-beta-HSD1 / HSD3B1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 3-beta-hydroxysteroid dehydrogenase, Delta 5-->4-isomerase type 1, Trophoblast Marker
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14060
Immunogen:
HSD3B1 (NP_000853.1, 1 a.a. ~ 373 a.a) full-length human protein.
AA Sequence:
MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDV SVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWP APYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGN VAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFL LRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ
Genename:
3283
Remarks:
Gene Accession: NM_000862.1
Add. information Rabbit polyclonal antibody raised against a full-length human HSD3B1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3283

Accessory Products

Proteins and/or Positive Controls

Positive controls for 3-beta-HSD1 / HSD3B1 (2 products)

Catalog No. Species Pres. Purity   Source  
H00003283-T01

HSD3B1 293T Cell Transient Overexpression Lysate(Denatured)

HSD3B1 293T Cell Transient Overexpression Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
NBL1-11732

HSD3B1 Lysate

Western Blot: HSD3B1 Lysate [NBL1-11732] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSD3B1
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn