H00000496-B01P ATP4B antibody

See related secondary antibodies

Search for all "ATP4B"

50 µg / €340.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ATP4B

Product Description for ATP4B

Mouse anti Human ATP4B.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ATP4B

Product Category Antibodies
Target Category
Quantity 50 µg
Synonyms Gastric H(+)/K(+) ATPase subunit beta, Potassium-transporting ATPase subunit beta, Proton pump ATPase beta chain
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51164
Immunogen:
ATP4B (AAH29059, 1 a.a. ~ 292 a.a) full-length human protein.
AA Sequence:
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQ LRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSC KFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLH YFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK*
Genename:
496
Remarks:
Gene Accession: BC029059
Antibody type Ab
Add. information Mouse polyclonal antibody raised against a full-length human ATP4B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 496
FocusOn and Reviews
Reviews:

Accessory Products

Proteins and/or Positive Controls

Proteins for ATP4B (3 products)

Catalog No. Species Pres. Purity   Source  
H00000496-P01-02

ATP4B

ATP4B Human in vitro transl.
2 µg / €250.00
  Abnova Taiwan Corp.
H00000496-Q01-10

ATP4B

ATP4B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €350.00
  Abnova Taiwan Corp.
H00000496-Q01-25

ATP4B

ATP4B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for ATP4B (3 products)

Catalog No. Species Pres. Purity   Source  
H00000496-T02

ATP4B 293T Cell Transient Overexpression Lysate(Denatured)

ATP4B 293T Cell Transient Overexpression Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
H00000496-T01

ATP4B Lysate(Denatured)

ATP4B Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
NBL1-07815

Hydrogen Potassium ATPase Beta Lysate

Western Blot: Hydrogen Potassium ATPase Beta Lysate [NBL1-07815] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ATP4B
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn