H00006774-B01P STAT3 antibody

See related secondary antibodies

Search for all "STAT3"

50 µg / €340.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human STAT3

Product Description for STAT3

Mouse anti Human STAT3.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for STAT3

Product Category Antibodies
Quantity 50 µg
Synonyms APRF, Acute-phase response factor, STAT-3, Signal transducer and activator of transcription 3
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
P40763
Immunogen:
STAT3 (AAH14482.1, 1 a.a. ~ 770 a.a) full-length human protein.
AA Sequence:
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESN VLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVR KRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAM EYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPM LEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRG SRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLET HSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKL LGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLL RFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFG KYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDME LTSECATSPM
Genename:
6774
Remarks:
Gene Accession: NM_139276
Antibody type Ab
Add. information Mouse polyclonal antibody raised against a full-length human STAT3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6774
FocusOn and Reviews
Reviews:
Targets

Accessory Products

Proteins and/or Positive Controls

Proteins for STAT3 (2 products)

Catalog No. Species Pres. Purity   Source  
H00006774-P01-10

STAT3

STAT3 Human in vitro transl.
10 µg / €350.00
  Abnova Taiwan Corp.
H00006774-P01-25

STAT3

STAT3 Human in vitro transl.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for STAT3 (2 products)

Catalog No. Species Pres. Purity   Source  
NBL1-16525

STAT3 Lysate

Western Blot: STAT3 Lysate [NBL1-16525] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STAT3
0.1 mg / €520.00
  Novus Biologicals Inc.
NBL1-16526

STAT3 Lysate

Western Blot: STAT3 Lysate [NBL1-16526] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STAT3
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn