H00006775-D01P STAT4 antibody

See related secondary antibodies

Search for all "STAT4"

0.1 mg / €360.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human STAT4

Product Description for STAT4

Rabbit anti Human STAT4.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for STAT4

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Signal transducer and activator of transcription 4
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14765
Immunogen:
STAT4 (AAH31212.1, 1 a.a. ~ 748 a.a) full-length human protein.
AA Sequence:
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGRVSKEKN LLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKN SVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMN TMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHMLERV TFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVKASIDKNVSTLSNRRFVLCGT NVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISN VSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGH LTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGIT FTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSR PTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE
Genename:
6775
Remarks:
Gene Accession: NM_003151.2
Add. information Rabbit polyclonal antibody raised against a full-length human STAT4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6775
FocusOn and Reviews
Reviews:

Accessory Products

Proteins and/or Positive Controls

Proteins for STAT4 (3 products)

Catalog No. Species Pres. Purity   Source  
GTX28002

STAT4 Control Peptide

STAT4 n/a
0.1 mg / €230.00
  GeneTex Inc.
H00006775-P01-10

STAT4

STAT4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
10 µg / €350.00
  Abnova Taiwan Corp.
H00006775-P01-25

STAT4

STAT4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for STAT4 (2 products)

Catalog No. Species Pres. Purity   Source  
H00006775-T01

STAT4 293T Cell Transient Overexpression Lysate(Denatured)

STAT4 293T Cell Transient Overexpression Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
NBL1-16527

STAT4 Lysate

Western Blot: STAT4 Lysate [NBL1-16527] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STAT4
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn