H00006776-D01P STAT5 / STAT5A antibody

See related secondary antibodies

Search for all "STAT5 / STAT5A"

0.1 mg / €360.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human STAT5 / STAT5A

H00006776-D01P

More Views

  • H00006776-D01P
  • H00006776-D01P

Product Description for STAT5 / STAT5A

Rabbit anti Human STAT5 / STAT5A.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for STAT5 / STAT5A

Product Category Antibodies
Target Category
Quantity 0.1 mg
Synonyms MGF, Mammary gland factor, STAT-5, STAT-5A, Signal transducer and activator of transcription 5A
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
P42229
Immunogen:
STAT5A (NP_003143.2, 1 a.a. ~ 794 a.a) full-length human protein.
AA Sequence:
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQV GEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQKHLQINQTFEELR LVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVE LAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLP IPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAK SLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELV FQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVF LAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLI NKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYT PVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDV ARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
Genename:
6776
Remarks:
Gene Accession: NM_003152.2
Antibody type Ab
Add. information Rabbit polyclonal antibody raised against a full-length human STAT5A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,PLA-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6776
FocusOn and Reviews
Reviews:

Accessory Products

Proteins and/or Positive Controls

Proteins for STAT5 / STAT5A (5 products)

Catalog No. Species Pres. Purity   Source  
GTX28003

STAT5 / STAT5A

STAT5 / STAT5A n/a
0.1 mg / €230.00
  GeneTex Inc.
H00006776-P01-10

STAT5 / STAT5A

STAT5 / STAT5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €350.00
  Abnova Taiwan Corp.
H00006776-P01-25

STAT5 / STAT5A

STAT5 / STAT5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €500.00
  Abnova Taiwan Corp.
H00006776-Q01-10

STAT5 / STAT5A

STAT5 / STAT5A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
10 µg / €350.00
  Abnova Taiwan Corp.
H00006776-Q01-25

STAT5 / STAT5A

STAT5 / STAT5A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for STAT5 / STAT5A (2 products)

Catalog No. Species Pres. Purity   Source  
H00006776-T01

STAT5A 293T Cell Transient Overexpression Lysate(Denatured)

STAT5A 293T Cell Transient Overexpression Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
NBL1-16528

STAT5A Lysate

Western Blot: STAT5A Lysate [NBL1-16528] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STAT5A
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn