H00006778-B01 STAT6 antibody

See related secondary antibodies

Search for all "STAT6"

50 µl / €340.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human STAT6

H00006778-B01

More Views

  • H00006778-B01
  • H00006778-B01

Product Description for STAT6

Mouse anti Human STAT6.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for STAT6

Product Category Antibodies
Quantity 50 µl
Synonyms IL-4 Stat, Signal transducer and activator of transcription 6
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
P42226
Immunogen:
STAT6 (NP_003144.3, 1 a.a. ~ 847 a.a) full-length human protein.
AA Sequence:
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGST ILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQ KGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERC ESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLRFLGA PAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALFKNLLLKKIKRCERKGTESVT EEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLN LKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSY WSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRD LAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQL GPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPL LCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISM SHMDLRANPSW
Genename:
6778
Remarks:
Gene Accession: NM_003153.3
Antibody type Ab
Add. information Mouse polyclonal antibody raised against a full-length human STAT6 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 6778
FocusOn and Reviews
Reviews:
Targets

Accessory Products

Proteins and/or Positive Controls

Proteins for STAT6 (3 products)

Catalog No. Species Pres. Purity   Source  
GTX22425

STAT6 Control Peptide

STAT6
0.5 ml / €230.00
  GeneTex Inc.
H00006778-Q01-10

STAT6

STAT6 Human in vitro transl.
10 µg / €350.00
  Abnova Taiwan Corp.
H00006778-Q01-25

STAT6

STAT6 Human in vitro transl.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for STAT6 (2 products)

Catalog No. Species Pres. Purity   Source  
H00006778-T01

STAT6 293T Cell Transient Overexpression Lysate(Denatured)

STAT6 293T Cell Transient Overexpression Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
NBL1-16529

STAT6 Lysate

Western Blot: STAT6 Lysate [NBL1-16529] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for STAT6.
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn