H00007415-M15 TER ATPase / VCP antibody

See related secondary antibodies

Search for all "TER ATPase / VCP"

0.1 mg / €340.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TER ATPase / VCP 2H5

H00007415-M15

Product Description for TER ATPase / VCP

Mouse anti Human TER ATPase / VCP 2H5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TER ATPase / VCP

Product Category Antibodies
Quantity 0.1 mg
Synonyms 15S Mg(2+)-ATPase p97 subunit, Transitional endoplasmic reticulum ATPase, Valosin-containing protein
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2H5
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55072
Immunogen:
VCP (AAH07562, 221 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ SNPSALRETVVEVP*
Genename:
7415
Remarks:
Gene Accession: BC007562
Antibody type Ab
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant VCP.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7415
FocusOn and Reviews
Reviews:
Targets

Accessory Products

Proteins and/or Positive Controls

Proteins for TER ATPase / VCP (10 products)

Catalog No. Species Pres. Purity   Source  
H00007415-P01-10

TER ATPase / VCP

TER ATPase / VCP Human Purified
10 µg / €350.00
  Abnova Taiwan Corp.
H00007415-P01-25

TER ATPase / VCP

TER ATPase / VCP Human Purified
25 µg / €500.00
  Abnova Taiwan Corp.
H00007415-P02

TER ATPase / VCP

TER ATPase / VCP Human Purified
10 µg / €420.00
  Abnova Taiwan Corp.
H00007415-P02-10

TER ATPase / VCP

TER ATPase / VCP Human Purified
10 µg / €350.00
  Abnova Taiwan Corp.
H00007415-P02-25

TER ATPase / VCP

TER ATPase / VCP Human Purified
25 µg / €500.00
  Abnova Taiwan Corp.
H00007415-Q01-10

TER ATPase / VCP

TER ATPase / VCP Human Purified
10 µg / €350.00
  Abnova Taiwan Corp.
H00007415-Q01-25

TER ATPase / VCP

TER ATPase / VCP Human Purified
25 µg / €500.00
  Abnova Taiwan Corp.
H00007415-Q02

TER ATPase / VCP

TER ATPase / VCP Human Purified
10 µg / €330.00
  Abnova Taiwan Corp.
H00007415-Q02-10

TER ATPase / VCP

TER ATPase / VCP Human Purified
10 µg / €350.00
  Abnova Taiwan Corp.
H00007415-Q02-25

TER ATPase / VCP

TER ATPase / VCP Human Purified
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for TER ATPase / VCP (1 products)

Catalog No. Species Pres. Purity   Source  
NBL1-17707

p97/VCP Lysate

Western Blot: p97/VCP Lysate [NBL1-17707] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VCP
0.1 mg / €370.00
  Novus Biologicals Inc.
  • Pinterest
  • LinkedIn