H00007791-A01 Zyxin antibody

See related secondary antibodies

Search for all "Zyxin"

50 µl / €260.00
Please visit the appropriate website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human Zyxin

H00007791-A01

Product Description for Zyxin

Mouse anti Human Zyxin.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Zyxin

Product Category Antibodies
Quantity 50 µl
Synonyms ZYX, Zyxin-2
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15942
Immunogen:
ZYX (AAH08743, 1 a.a. ~ 573 a.a) full- length recombinant protein with GST tag.
AA Sequence:
MAAPRPSPAISVSVSAPAFYAPQEKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPP PLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDSLS SLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQP QPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSA GTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAV NELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRML RATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHM KCYECEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT*
Genename:
7791
Remarks:
Gene Accession: BC008743
Antibody type Ab
Add. information Mouse polyclonal antibody raised against a full-length recombinant ZYX.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 7791
Targets

Accessory Products

Proteins and/or Positive Controls

Proteins for Zyxin (2 products)

Catalog No. Species Pres. Purity   Source  
H00007791-P01-10

Zyxin

Zyxin Human in vitro transl.
10 µg / €350.00
  Abnova Taiwan Corp.
H00007791-P01-25

Zyxin

Zyxin Human in vitro transl.
25 µg / €500.00
  Abnova Taiwan Corp.

Positive controls for Zyxin (1 products)

Catalog No. Species Pres. Purity   Source  
H00007791-T01

ZYX 293T Cell Transient Overexpression Lysate(Denatured)

ZYX 293T Cell Transient Overexpression Lysate(Denatured)
0.1 ml / €240.00
  Abnova Taiwan Corp.
  • Pinterest
  • LinkedIn