discontinued

H00007534-B01 14-3-3 protein beta+zeta antibody

See related secondary antibodies

Search for all "14-3-3 protein beta+zeta"

50 µl / €370.00

Quick Overview

Mouse anti Human 14-3-3 protein beta+zeta

Product Description for 14-3-3 protein beta+zeta

Mouse anti Human 14-3-3 protein beta+zeta.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for 14-3-3 protein beta+zeta

Product Category Primary Antibodies
Quantity 50 µl
Synonyms KCIP-1, Protein Kinase C Inhibitor Protein 1, YWHAB, YWHAZ
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
YWHAZ (NP_003397, 1 a.a. ~ 245 a.a) full-length human protein.
AA Sequence:
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQ QMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEA FEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW TSDTQGDEAEAGEGGEN
Remarks:
Gene Accession: NM_003406
Add. information Mouse polyclonal antibody raised against a full-length human YWHAZ protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn