discontinued

H00007532-M01 14-3-3 protein gamma antibody

See related secondary antibodies

Search for all "14-3-3 protein gamma"

Quick Overview

Mouse anti Human 14-3-3 protein gamma 3G3

Product Description for 14-3-3 protein gamma

Mouse anti Human 14-3-3 protein gamma 3G3.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Properties for 14-3-3 protein gamma

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms KCIP-1, Protein kinase C inhibitor protein 1, YWHAG
Presentation Purified
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 3G3
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P61981
Immunogen:
YWHAG (NP_036611, 67 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEK RATVVESSEKAYSEAHEISKEHMQ*
GeneID:
7532
Remarks:
Gene Accession: NM_012479
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant YWHAG.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7532

Accessory Products

Proteins and/or Positive Controls

Proteins for 14-3-3 protein gamma (10 products)

Catalog No. Species Pres. Purity   Source  

14-3-3 protein gamma

14-3-3 protein gamma Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

14-3-3 protein gamma (1-247)

14-3-3 protein gamma Human Purified ≥ 95 by SDS-PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

14-3-3 protein gamma (1-247)

14-3-3 protein gamma Human Purified ≥ 95 by SDS-PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

14-3-3 protein gamma

14-3-3 protein gamma Human in vitro transl.
  Abnova Taiwan Corp.

14-3-3 protein gamma

14-3-3 protein gamma Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

14-3-3 protein gamma

14-3-3 protein gamma Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

14-3-3 protein gamma

14-3-3 protein gamma Human Purified
  Abnova Taiwan Corp.

14-3-3 protein gamma

14-3-3 protein gamma Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

14-3-3 protein gamma

14-3-3 protein gamma Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

14-3-3 protein gamma

SDS-Page: 14-3-3 gamma Protein [NBC1-18391] - 14-3-3 gamma, 28 kDa ( 247 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for 14-3-3 protein gamma (1 products)

Catalog No. Species Pres. Purity   Source  

14-3-3 gamma Lysate

Western Blot: 14-3-3 gamma Lysate [NBL1-17949] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for YWHAG
  Novus Biologicals Inc.
  • LinkedIn