TA334404 14-3-3 protein sigma / SFN antibody

Rabbit Polyclonal Anti-SFN Antibody

See related secondary antibodies

Search for all "14-3-3 protein sigma / SFN"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat 14-3-3 protein sigma / SFN

Product Description for 14-3-3 protein sigma / SFN

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat 14-3-3 protein sigma / SFN.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for 14-3-3 protein sigma / SFN

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Epithelial cell marker protein 1, HME1, Stratifin
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-SFN antibody: synthetic peptide directed towards the N terminal of human SFN. Synthetic peptide located within the following region: VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL.
Application WB
Background SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized sigling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for 14-3-3 protein sigma / SFN (11 products)

Catalog No. Species Pres. Purity   Source  

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

14-3-3 protein sigma / SFN (1-248)

14-3-3 protein sigma / SFN Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €670.00
  OriGene Technologies GmbH

14-3-3 protein sigma / SFN (1-248)

14-3-3 protein sigma / SFN Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €250.00
  OriGene Technologies GmbH

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human Purified 95 % E. coli
  GenWay Biotech Inc.

14-3-3 protein sigma / SFN

14-3-3 protein sigma / SFN Human Purified 95 % E. coli
  GenWay Biotech Inc.

14-3-3 protein sigma / SFN

Wetern Blot: 14-3-3 sigma/Stratifin Protein [NBP1-30172] - 15% SDS-PAGE (3ug)
  Novus Biologicals Inc.

Positive controls for 14-3-3 protein sigma / SFN (2 products)

Catalog No. Species Pres. Purity   Source  

14-3-3 sigma Lysate

Western Blot: 14-3-3 sigma/Stratifin  Lysate [NBL1-15882] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SFN
  Novus Biologicals Inc.

SFN overexpression lysate

SFN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn