discontinued

H00003292-M03A 17-beta-HSD1 / HSD17B1 antibody

See related secondary antibodies

Search for all "17-beta-HSD1 / HSD17B1"

Quick Overview

Mouse anti Human 17-beta-HSD1 / HSD17B1 2E5

Product Description for 17-beta-HSD1 / HSD17B1

Mouse anti Human 17-beta-HSD1 / HSD17B1 2E5.
Presentation: Ascites
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for 17-beta-HSD1 / HSD17B1

Product Category Primary Antibodies
Target Category
Quantity 0.2 ml
Synonyms 17-beta-hydroxysteroid dehydrogenase type 1, 17E2DH, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha HSD, E17KSR, EDH17B1, EDH17B2, EDHB17, Estradiol 17-beta-dehydrogenase 1, Placental 17-beta-hydroxysteroid dehydrogenase
Presentation Ascites
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2E5
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P14061
Immunogen:
HSD17B1 (NP_000404, 189 a.a. ~ 286 a.a) partial recombinant protein with GST tag.
AA Sequence:
VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLL RMRLDDPSGSNYVTAMHREVF*
GeneID:
3292
Remarks:
Gene Accession: NM_000413
Add. information Mouse monoclonal antibody raised against a partial recombinant HSD17B1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In ascites fluid
Format
Label:
None
Purification:
Ascites
Buffer System:
In ascites fluid
Purity:
Ascites
State:
Ascites
Specificity
Species:
Human
Gene ID 3292

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta-HSD1 / HSD17B1 (4 products)

Catalog No. Species Pres. Purity   Source  

17-beta-HSD1 / HSD17B1 (1-328, His-tag)

17-beta-HSD1 / HSD17B1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €730.00
  OriGene Technologies GmbH

17-beta-HSD1 / HSD17B1 (1-328, His-tag)

17-beta-HSD1 / HSD17B1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €300.00
  OriGene Technologies GmbH

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn