TA346185 17-beta-HSD1 / HSD17B1 antibody

Rabbit Polyclonal Anti-HSD17B1 Antibody

See related secondary antibodies

Search for all "17-beta-HSD1 / HSD17B1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat 17-beta-HSD1 / HSD17B1

TA346185

More Views

  • TA346185

Product Description for 17-beta-HSD1 / HSD17B1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat 17-beta-HSD1 / HSD17B1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for 17-beta-HSD1 / HSD17B1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 17-beta-hydroxysteroid dehydrogenase type 1, 17E2DH, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha HSD, E17KSR, EDH17B1, EDH17B2, EDHB17, Estradiol 17-beta-dehydrogenase 1, Placental 17-beta-hydroxysteroid dehydrogenase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14061
Immunogen:
The immunogen for anti-HSD17B1 antibody: synthetic peptide directed towards the N terminal of human HSD17B1. Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA.
GeneID:
3292
Application WB
IHC
Background HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta-HSD1 / HSD17B1 (4 products)

Catalog No. Species Pres. Purity   Source  

17-beta-HSD1 / HSD17B1 (1-328, His-tag)

17-beta-HSD1 / HSD17B1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €730.00
  OriGene Technologies GmbH

17-beta-HSD1 / HSD17B1 (1-328, His-tag)

17-beta-HSD1 / HSD17B1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €300.00
  OriGene Technologies GmbH

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn