discontinued

H00051170-B01 17-beta-HSD11 / HSD17B11 antibody

See related secondary antibodies

Search for all "17-beta-HSD11 / HSD17B11"

Quick Overview

Mouse anti Human 17-beta-HSD11 / HSD17B11

Product Description for 17-beta-HSD11 / HSD17B11

Mouse anti Human 17-beta-HSD11 / HSD17B11.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for 17-beta-HSD11 / HSD17B11

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms 17-beta-HSD XI, 17-beta-hydroxysteroid dehydrogenase 11, CTCL tumor antigen HD-CL-03, Cutaneous T-cell lymphoma-associated antigen HD-CL-03, DHRS8, Dehydrogenase/reductase SDR family member 8, Estradiol 17-beta-dehydrogenase 11, PAN1B, PSEC0029, Retinal short-chain dehydrogenase/reductase 2
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBQ5
Immunogen:
DHRS8 (AAH36001.1, 1 a.a. ~ 300 a.a) full-length human protein.
AA Sequence:
MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEET AAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTT KAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKN PSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGYKMKAQ
GeneID:
51170
Remarks:
Gene Accession: NM_016245.2
Add. information Mouse polyclonal antibody raised against a full-length human DHRS8 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 51170

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta-HSD11 / HSD17B11 (7 products)

Catalog No. Species Pres. Purity   Source  

17-beta-HSD11 / HSD17B11

17-beta-HSD11 / HSD17B11 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

17-beta-HSD11 / HSD17B11 (20-285, His-tag)

17-beta-HSD11 / HSD17B11 Human Purified > 95 % E. coli
0.5 mg / €1,000.00
  OriGene Technologies GmbH

17-beta-HSD11 / HSD17B11 (20-285, His-tag)

17-beta-HSD11 / HSD17B11 Human Purified > 95 % E. coli
0.1 mg / €370.00
  OriGene Technologies GmbH

17-beta-HSD11 / HSD17B11

17-beta-HSD11 / HSD17B11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta-HSD11 / HSD17B11

17-beta-HSD11 / HSD17B11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta-HSD11 / HSD17B11 (17-beta)

17-beta-HSD11 / HSD17B11 Human Purified
  Novus Biologicals Inc.

17-beta-HSD11 / HSD17B11 (17-beta)

17-beta-HSD11 / HSD17B11 Human Purified
  Novus Biologicals Inc.

Positive controls for 17-beta-HSD11 / HSD17B11 (2 products)

Catalog No. Species Pres. Purity   Source  

DHRS8 293T Cell Transient Overexpression Lysate(Denatured)

DHRS8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSD17B11 overexpression lysate

HSD17B11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn