discontinued

H00051171-B01P 17-beta HSD14 / HSD17B14 antibody

See related secondary antibodies

Search for all "17-beta HSD14 / HSD17B14"

Quick Overview

Mouse anti Human 17-beta HSD14 / HSD17B14

Product Description for 17-beta HSD14 / HSD17B14

Mouse anti Human 17-beta HSD14 / HSD17B14.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for 17-beta HSD14 / HSD17B14

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 17-beta-hydroxysteroid dehydrogenase 14, 17-beta-hydroxysteroid dehydrogenase DHRS10, DHRS10, Dehydrogenase/reductase SDR family member 10, Retinal short-chain dehydrogenase/reductase retSDR3, SDR3
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BPX1
Immunogen:
HSD17B14 (NP_057330.2, 1 a.a. ~ 270 a.a) full-length human protein.
AA Sequence:
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSET IRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAV PYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAA VFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
GeneID:
51171
Remarks:
Gene Accession: NM_016246.2
Add. information Mouse polyclonal antibody raised against a full-length human HSD17B14 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 51171

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta HSD14 / HSD17B14 (7 products)

Catalog No. Species Pres. Purity   Source  

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

17-beta HSD14 / HSD17B14 (1-270, His-tag)

17-beta HSD14 / HSD17B14 Human Purified > 95 % E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

17-beta HSD14 / HSD17B14 (1-270, His-tag)

17-beta HSD14 / HSD17B14 Human Purified > 95 % E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified
  Novus Biologicals Inc.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified
  Novus Biologicals Inc.

Positive controls for 17-beta HSD14 / HSD17B14 (2 products)

Catalog No. Species Pres. Purity   Source  

DHRS10 293T Cell Transient Overexpression Lysate(Denatured)

DHRS10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSD17B14 overexpression lysate

HSD17B14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn