TA345048 17-beta HSD14 / HSD17B14 antibody

Rabbit Polyclonal Anti-HSD17B14 Antibody - middle region

See related secondary antibodies

Search for all "17-beta HSD14 / HSD17B14"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human 17-beta HSD14 / HSD17B14

Product Description for 17-beta HSD14 / HSD17B14

Rabbit anti Human 17-beta HSD14 / HSD17B14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for 17-beta HSD14 / HSD17B14

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 17-beta-hydroxysteroid dehydrogenase 14, 17-beta-hydroxysteroid dehydrogenase DHRS10, DHRS10, Dehydrogenase/reductase SDR family member 10, Retinal short-chain dehydrogenase/reductase retSDR3, SDR3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BPX1
Immunogen:
The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the middle region of human HSD17B14. Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP.
GeneID:
51171
Application WB
Background 17-beta-hydroxysteroid dehydrogeses, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM, Jun 2009]. ##Evidence-Data-START## Transcript exon combition :: AF126781.1, BC006283.2 [ECO:0000332] Rseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END##
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta HSD14 / HSD17B14 (7 products)

Catalog No. Species Pres. Purity   Source  

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

17-beta HSD14 / HSD17B14 (1-270, His-tag)

17-beta HSD14 / HSD17B14 Human Purified > 95 % E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

17-beta HSD14 / HSD17B14 (1-270, His-tag)

17-beta HSD14 / HSD17B14 Human Purified > 95 % E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified
  Novus Biologicals Inc.

17-beta HSD14 / HSD17B14

17-beta HSD14 / HSD17B14 Human Purified
  Novus Biologicals Inc.

Positive controls for 17-beta HSD14 / HSD17B14 (2 products)

Catalog No. Species Pres. Purity   Source  

DHRS10 293T Cell Transient Overexpression Lysate(Denatured)

DHRS10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSD17B14 overexpression lysate

HSD17B14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn