discontinued

H00003294-D01P 17-beta-HSD2 / HSD17B2 antibody

See related secondary antibodies

Search for all "17-beta-HSD2 / HSD17B2"

Quick Overview

Rabbit anti Human, Mouse 17-beta-HSD2 / HSD17B2

H00003294-D01P

More Views

  • H00003294-D01P
  • H00003294-D01P

Product Description for 17-beta-HSD2 / HSD17B2

Rabbit anti Human, Mouse 17-beta-HSD2 / HSD17B2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for 17-beta-HSD2 / HSD17B2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 20-alpha HSD, E2DH, EDH17B2, Estradiol 17-beta-dehydrogenase 2, Microsomal 17-beta-hydroxysteroid dehydrogenase, Testosterone 17-beta-dehydrogenase
Presentation Purified
Reactivity Hu, Ms
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P37059
Immunogen:
HSD17B2 (NP_002144.1, 1 a.a. ~ 387 a.a) full-length human protein.
AA Sequence:
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQE LLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKV AAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMER LASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQR NFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMP NYKKKAT
GeneID:
3294
Remarks:
Gene Accession: NM_002153.1
Add. information Rabbit polyclonal antibody raised against a full-length human HSD17B2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 3294

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta-HSD2 / HSD17B2 (6 products)

Catalog No. Species Pres. Purity   Source  

17-beta-HSD2 / HSD17B2

17-beta-HSD2 / HSD17B2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

17-beta-HSD2 / HSD17B2

17-beta-HSD2 / HSD17B2 Human in vitro transl.
  Abnova Taiwan Corp.

17-beta-HSD2 / HSD17B2

17-beta-HSD2 / HSD17B2 Human in vitro transl.
  Abnova Taiwan Corp.

17-beta-HSD2 / HSD17B2

17-beta-HSD2 / HSD17B2 Human in vitro transl.
  Abnova Taiwan Corp.

17-beta-HSD2 / HSD17B2

17-beta-HSD2 / HSD17B2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

17-beta-HSD2 / HSD17B2

17-beta-HSD2 / HSD17B2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for 17-beta-HSD2 / HSD17B2 (4 products)

Catalog No. Species Pres. Purity   Source  

HSD17B2 293T Cell Transient Overexpression Lysate(Denatured)

HSD17B2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSD17B2 293T Cell Transient Overexpression Lysate(Denatured)

HSD17B2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSD17B2 Lysate

Western Blot: HSD17B2 Lysate [NBL1-11726] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSD17B2
  Novus Biologicals Inc.

HSD17B2 overexpression lysate

HSD17B2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn