discontinued

NBP1-56980 26S Proteasome regulatory subunit p55 antibody

See related secondary antibodies

Search for all "26S Proteasome regulatory subunit p55"

Quick Overview

Rabbit anti Human 26S Proteasome regulatory subunit p55

Product Description for 26S Proteasome regulatory subunit p55

Rabbit anti Human 26S Proteasome regulatory subunit p55.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for 26S Proteasome regulatory subunit p55

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC75406, p55
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q00232
Immunogen:
Synthetic peptides corresponding to PSMD12 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 12) The peptide sequence was selected from the N terminal of PSMD12. Peptide sequence MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSL.
GeneID:
2960253
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 3.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 2960253

Accessory Products

  • LinkedIn