NBP1-56983 26S Proteasome regulatory subunit p55 antibody

See related secondary antibodies

Search for all "26S Proteasome regulatory subunit p55"

50 µg / €390.00

Quick Overview

Rabbit anti Human 26S Proteasome regulatory subunit p55

Product Description for 26S Proteasome regulatory subunit p55

Rabbit anti Human 26S Proteasome regulatory subunit p55.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for 26S Proteasome regulatory subunit p55

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC75406, p55
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PSMD12 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 12) The peptide sequence was selected from the middle region of PSMD12. Peptide sequence KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEK
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 3.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 100172410

Accessory Products

  • LinkedIn