discontinued

H00003284-M02 3-beta HSD2 / HSD3B2 antibody

See related secondary antibodies

Search for all "3-beta HSD2 / HSD3B2"

Quick Overview

Mouse anti Human 3-beta HSD2 / HSD3B2 1E8

Product Description for 3-beta HSD2 / HSD3B2

Mouse anti Human 3-beta HSD2 / HSD3B2 1E8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for 3-beta HSD2 / HSD3B2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 3-beta-HSD II, 3-beta-hydroxysteroid dehydrogenase, Delta 5-->4-isomerase type 2, HSDB3B
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1E8
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P26439
Immunogen:
HSD3B2 (NP_000189, 33 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLL EACVQASVPVFIYT*
GeneID:
3284
Remarks:
Gene Accession: NM_000198
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant HSD3B2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3284

Accessory Products

Proteins and/or Positive Controls

Proteins for 3-beta HSD2 / HSD3B2 (6 products)

Catalog No. Species Pres. Purity   Source  

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

3-beta HSD2 / HSD3B2 (transcript variant 2)

3-beta HSD2 / HSD3B2 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for 3-beta HSD2 / HSD3B2 (1 products)

Catalog No. Species Pres. Purity   Source  

Beta Hydroxysteroid Dehydrogenase Lysate

Western Blot: Beta Hydroxysteroid Dehydrogenase Lysate [NBL1-11733] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSD3B2
  Novus Biologicals Inc.
  • LinkedIn