TA334658 3-beta HSD2 / HSD3B2 antibody

Rabbit Polyclonal Anti-HSD3B2 Antibody

See related secondary antibodies

Search for all "3-beta HSD2 / HSD3B2"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Rat, Sheep 3-beta HSD2 / HSD3B2

TA334658

More Views

  • TA334658
  • TA334658

Product Description for 3-beta HSD2 / HSD3B2

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Rat, Sheep 3-beta HSD2 / HSD3B2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for 3-beta HSD2 / HSD3B2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 3-beta-HSD II, 3-beta-hydroxysteroid dehydrogenase, Delta 5-->4-isomerase type 2, HSDB3B
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Ms, Rt, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26439
Immunogen:
The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN.
GeneID:
3284
Application IHC
WB
Background 3-beta-HSD is a bifunctiol enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormol steroids.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for 3-beta HSD2 / HSD3B2 (6 products)

Catalog No. Species Pres. Purity   Source  

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

3-beta HSD2 / HSD3B2 (transcript variant 2)

3-beta HSD2 / HSD3B2 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for 3-beta HSD2 / HSD3B2 (1 products)

Catalog No. Species Pres. Purity   Source  

Beta Hydroxysteroid Dehydrogenase Lysate

Western Blot: Beta Hydroxysteroid Dehydrogenase Lysate [NBL1-11733] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSD3B2
  Novus Biologicals Inc.
  • LinkedIn