TA339548 3-beta HSD7 / HSD3B7 (Center) antibody

Rabbit Polyclonal Anti-HSD3B7 Antibody

See related secondary antibodies

Search for all "3-beta HSD7 / HSD3B7"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human 3-beta HSD7 / HSD3B7

Product Description for 3-beta HSD7 / HSD3B7

Rabbit anti Human 3-beta HSD7 / HSD3B7.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for 3-beta HSD7 / HSD3B7

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase, 7-alpha-diol 3-beta-dehydrogenase, Cholest-5-ene-3-beta
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2F3
Immunogen:
Synthetic peptide directed towards the middle region of human HSD3B7
AA Sequence:
QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR
GeneID:
80270
Property Center
Application

Western blotting  (0.2 -1 µg/ml).

Background This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.
Storage

Store lyophilized at 2-8°C for one month or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Format
Purification:
Immunoaffinity column
State:
Lyophilized from PBS
Aff - Purified
Reconstitution:
Add 50 µl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Rabbit, Guinea Pig, Dog, Bovine, Pig
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for 3-beta HSD7 / HSD3B7 (4 products)

Catalog No. Species Pres. Purity   Source  

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for 3-beta HSD7 / HSD3B7 (1 products)

Catalog No. Species Pres. Purity   Source  

HSD3B7 Lysate

Western Blot: HSD3B7 Lysate [NBL1-11734] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HSD3B7.
  Novus Biologicals Inc.
  • LinkedIn