TA330770 AARSD1 antibody

Rabbit Polyclonal Anti-PTGES3L-AARSD1 Antibody

See related secondary antibodies

Search for all "AARSD1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat AARSD1

Product Description for AARSD1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat AARSD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AARSD1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Alanyl-tRNA synthetase domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTE6
Immunogen:
The immunogen for Anti-PTGES3L-AARSD1 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES3L-AARSD1. Synthetic peptide located within the following region: ELYNEIEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWPRLTKEDIKPV.
GeneID:
100885850
Application WB
Background This locus represents turally occurring readthrough transcription between the neighboring PTGES3L (prostaglandin E synthase 3 (cytosolic)-like) and AARSD1(alanyl-tR synthetase domain containing 1) genes on chromosome 17. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AARSD1 (3 products)

Catalog No. Species Pres. Purity   Source  

AARSD1 (transcript variant 2)

AARSD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

AARSD1

AARSD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AARSD1

AARSD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for AARSD1 (4 products)

Catalog No. Species Pres. Purity   Source  

AARSD1 293T Cell Transient Overexpression Lysate(Denatured)

AARSD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

AARSD1 Lysate

Western Blot: AARSD1 Lysate [NBL1-07166] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AARSD1 Protein
  Novus Biologicals Inc.

PTGES3L overexpression lysate

PTGES3L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PTGES3L overexpression lysate

PTGES3L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn