discontinued

NBP1-69012 ABCA1 antibody

See related secondary antibodies

Search for all "ABCA1"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse ABCA1

Product Description for ABCA1

Rabbit anti Human, Mouse ABCA1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ABCA1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1AWZ8
Immunogen:
Synthetic peptides corresponding to Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1) The peptide sequence was selected from the middle region of Abca1. Peptide sequence NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK.
GeneID:
11303
Background Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 11303

Accessory Products

  • LinkedIn