NBP1-69065 ABCB10 antibody

See related secondary antibodies

Search for all "ABCB10"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ABCB10


Product Description for ABCB10

Rabbit anti Human, Rat ABCB10.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ABCB10

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, subfamily B (MDR/TAP), member 10) The peptide sequence was selected from the middle region of Abcb10. Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
Background Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 361439

Accessory Products

  • LinkedIn