NBP1-69065 ABCB10 antibody

See related secondary antibodies

Search for all "ABCB10"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ABCB10

NBP1-69065

Product Description for ABCB10

Rabbit anti Human, Rat ABCB10.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ABCB10

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5FVL8
Immunogen:
Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, subfamily B (MDR/TAP), member 10) The peptide sequence was selected from the middle region of Abcb10. Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
GeneID:
361439
Background Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 361439

Accessory Products

  • LinkedIn