
NBP1-69065 ABCB10 antibody

See related secondary antibodies

Search for all "ABCB10"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Rat ABCB10


Product Description for ABCB10

Rabbit anti Human, Rat ABCB10.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ABCB10

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, subfamily B (MDR/TAP), member 10) The peptide sequence was selected from the middle region of Abcb10. Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
Background Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 361439

Accessory Products

  • LinkedIn