discontinued

H00000368-B01 ABCC6 / MRP6 antibody

See related secondary antibodies

Search for all "ABCC6 / MRP6"

50 µl / €370.00

Quick Overview

Mouse anti Human ABCC6 / MRP6

Product Description for ABCC6 / MRP6

Mouse anti Human ABCC6 / MRP6.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ABCC6 / MRP6

Product Category Primary Antibodies
Quantity 50 µl
Synonyms ARA, ATP-binding cassette sub-family C member 6, MOAT-E, Multi-specific organic anion transporter E, Multidrug resistance-associated protein 6
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A2RRN8
Immunogen:
ABCC6 (NP_001072996.1, 1 a.a. ~ 99 a.a) full-length human protein.
AA Sequence:
MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAA IPGSLEPGNVRGRQGTGWNLVKS
GeneID:
368
Remarks:
Gene Accession: BC050733.1
Add. information Mouse polyclonal antibody raised against a full-length human ABCC6 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human
Gene ID 368

Accessory Products

  • LinkedIn