75-296 ABCC9 / SUR2 (Isoform SUR2A) antibody

See related secondary antibodies

Search for all "ABCC9 / SUR2"

0.1 ml / €540.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Mouse, Rat ABCC9 / SUR2 N319A/14

Product Description for ABCC9 / SUR2

Mouse anti Mouse, Rat ABCC9 / SUR2 N319A/14.
Properties: (Isoform SUR2A)
Presentation: Purified
Product is tested for Frozen Sections, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ABCC9 / SUR2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2
Presentation Purified
Reactivity Ms, Rt
Applications C, ICC/IF, WB
Clonality Monoclonal
Clone N319A/14
Host Mouse
Isotype IgG2a
Molecular weight 120 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Antibodies Incorporated

Datasheet Extract

Swiss Prot Num:
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170).
Rat: 97% identity (41/42 amino acids identical).
Human: 92% identity (39/42 amino acids identical).
100% identity with SUR2C.
<50% identity with SUR2B.
Property Isoform SUR2A
Isotype control AM03096PU-N
Add. information USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
Application Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Does not cross-react with SUR2B

Accessory Products

  • LinkedIn