NBP1-58291 ABCF2 antibody

See related secondary antibodies

Search for all "ABCF2"

50 µg / €390.00

Quick Overview

Rabbit anti Human ABCF2


Product Description for ABCF2

Rabbit anti Human ABCF2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ABCF2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ABC28, DKFZp586K1823, EST133090, HUSSY-18, M-ABC1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ABCF2 (ATP-binding cassette, sub-family F (GCN20), member 2) The peptide sequence was selected from the middle region of ABCF2. Peptide sequence YGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETI.
Background The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 10061

Accessory Products

  • LinkedIn