NBP1-58292 ABCF2 antibody

See related secondary antibodies

Search for all "ABCF2"

Quick Overview

Rabbit anti Human ABCF2

Product Description for ABCF2

Rabbit anti Human ABCF2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ABCF2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ABC28, DKFZp586K1823, EST133090, HUSSY-18, M-ABC1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ABCF2(ATP-binding cassette, sub-family F (GCN20), member 2) The peptide sequence was selected from the N terminal of ABCF2. Peptide sequence DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL.
Background The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MD
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 10061

Accessory Products

  • LinkedIn