TA338020 ABHD6 antibody

Rabbit Polyclonal Anti-ABHD6 Antibody

See related secondary antibodies

Search for all "ABHD6"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ABHD6

Product Description for ABHD6

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ABHD6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ABHD6

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Abhydrolase domain-containing protein 6
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BV23
Immunogen:
The immunogen for anti-ABHD6 antibody is: synthetic peptide directed towards the C-terminal region of Human ABHD6. Synthetic peptide located within the following region: MLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD.
GeneID:
57406
Application WB
Background ABHD6 has 2-arachidonoylglycerol hydrolase activity. ABHD6 may be a regulator of endocanbinoid sigling pathways.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ABHD6 (3 products)

Catalog No. Species Pres. Purity   Source  

ABHD6

ABHD6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

ABHD6

ABHD6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABHD6

ABHD6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ABHD6 (1 products)

Catalog No. Species Pres. Purity   Source  

ABHD6 Lysate

Western Blot: ABHD6 Lysate [NBL1-07200] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ABHD6 Protein
  Novus Biologicals Inc.
  • LinkedIn