NBP1-81370 ABLIM2 antibody

See related secondary antibodies

Search for all "ABLIM2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ABLIM2

NBP1-81370

More Views

  • NBP1-81370
  • NBP1-81370

Product Description for ABLIM2

Rabbit anti Human ABLIM2.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for ABLIM2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6H8Q1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DGEDGSLDQDNRKKSSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDPLQRMAGDSFHSRFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDAS
GeneID:
84448
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84448

Accessory Products

Proteins and/or Positive Controls

Proteins for ABLIM2 (2 products)

Catalog No. Species Pres. Purity   Source  

Actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1 (transcript variant 1)

Actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7 (transcript variant 7)

Actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for ABLIM2 (7 products)

Catalog No. Species Pres. Purity   Source  

ABLIM2 overexpression lysate

ABLIM2 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.

ABLIM2 overexpression lysate

ABLIM2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ABLIM2 overexpression lysate

ABLIM2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ABLIM2 overexpression lysate

ABLIM2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ABLIM2 overexpression lysate

ABLIM2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ABLIM2 overexpression lysate

ABLIM2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ABLIM2 overexpression lysate

ABLIM2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn