TA338421 ABO antibody

Rabbit Polyclonal Anti-Abo Antibody

See related secondary antibodies

Search for all "ABO"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ABO

Product Description for ABO

Rabbit anti Human, Rat ABO.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ABO

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms A3GALNT, A3GALT1, Fucosylglycoprotein 3-alpha-galactosyltransferase, Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase, Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase, Glycoprotein-fucosylgalactoside alpha-galactosyltransferase, Histo-blood group A transferase, Histo-blood group ABO system transferase, Histo-blood group B transferase, NAGAT
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-Abo antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn