discontinued

H00080325-B01 ABTB1 antibody

See related secondary antibodies

Search for all "ABTB1"

Quick Overview

Mouse anti Human ABTB1

Product Description for ABTB1

Mouse anti Human ABTB1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ABTB1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Ankyrin repeat and BTB/POZ domain-containing protein 1, BPOZ, PP2259
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969K4
Immunogen:
ABTB1 (NP_115937.1, 1 a.a. ~ 336 a.a) full-length human protein.
AA Sequence:
MLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDIGVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASK PGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAGCSFLCHKAFFCGRS DYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR SLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEAVKEEAAAVAARQETDSIPLVDDIRFH VASTVQTYSAIEEAQQRLRALEDLLVSIGLDC
GeneID:
80325
Remarks:
Gene Accession: NM_032548.2
Add. information Mouse polyclonal antibody raised against a full-length human ABTB1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 80325

Accessory Products

Proteins and/or Positive Controls

Proteins for ABTB1 (5 products)

Catalog No. Species Pres. Purity   Source  

ABTB1 (full length, N-term HIS tag, transcript variant 1)

ABTB1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ABTB1

ABTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ABTB1 (1 products)

Catalog No. Species Pres. Purity   Source  

ABTB1 293T Cell Transient Overexpression Lysate(Denatured)

ABTB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn