discontinued

H00080325-M01 ABTB1 antibody

See related secondary antibodies

Search for all "ABTB1"

Quick Overview

Mouse anti Human ABTB1 3B3

Product Description for ABTB1

Mouse anti Human ABTB1 3B3.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Properties for ABTB1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Ankyrin repeat and BTB/POZ domain-containing protein 1, BPOZ, PP2259
Presentation Purified
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 3B3
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969K4
Immunogen:
ABTB1 (NP_742024, 271 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSP EAAYDVLSVADMYLLPGLKRLCGR*
GeneID:
80325
Remarks:
Gene Accession: NM_172027
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant ABTB1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 80325

Accessory Products

Proteins and/or Positive Controls

Proteins for ABTB1 (5 products)

Catalog No. Species Pres. Purity   Source  

ABTB1 (full length, N-term HIS tag, transcript variant 1)

ABTB1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ABTB1

ABTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ABTB1 (1 products)

Catalog No. Species Pres. Purity   Source  

ABTB1 293T Cell Transient Overexpression Lysate(Denatured)

ABTB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn