NBP1-91116 AC005014.4 antibody

See related secondary antibodies

Search for all "AC005014.4"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human AC005014.4

NBP1-91116

More Views

  • NBP1-91116

Product Description for AC005014.4

Rabbit anti Human AC005014.4.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for AC005014.4

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NJI9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANNVDKTVLDDPEDAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTETAQMLTVT
GeneID:
100506049
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 100506049

Accessory Products

Proteins and/or Positive Controls

Positive controls for AC005014.4 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC72 overexpression lysate

LRRC72 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn