NBP1-91120 AC013480.1 antibody

See related secondary antibodies

Search for all "AC013480.1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human AC013480.1

Product Description for AC013480.1

Rabbit anti Human AC013480.1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for AC013480.1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13J26
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA
GeneID:
4009500
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 4009500

Accessory Products

  • LinkedIn