NBP1-91119 AC040980.1 antibody

See related secondary antibodies

Search for all "AC040980.1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human AC040980.1

Product Description for AC040980.1

Rabbit anti Human AC040980.1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for AC040980.1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86WV5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTK
GeneID:
100134934
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 100134934

Accessory Products

Proteins and/or Positive Controls

Proteins for AC040980.1 (2 products)

Catalog No. Species Pres. Purity   Source  

TEN1 (1-123, His-tag)

TEN1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

TEN1 (1-123, His-tag)

TEN1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH

Positive controls for AC040980.1 (1 products)

Catalog No. Species Pres. Purity   Source  

TEN1 overexpression lysate

TEN1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn