discontinued

NBP1-91119 AC040980.1 antibody

See related secondary antibodies

Search for all "AC040980.1"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human AC040980.1

Product Description for AC040980.1

Rabbit anti Human AC040980.1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for AC040980.1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86WV5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTK
GeneID:
100134934
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 100134934

Accessory Products

Proteins and/or Positive Controls

Proteins for AC040980.1 (2 products)

Catalog No. Species Pres. Purity   Source  

TEN1 (1-123, His-tag)

TEN1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

TEN1 (1-123, His-tag)

TEN1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH

Positive controls for AC040980.1 (1 products)

Catalog No. Species Pres. Purity   Source  

TEN1 overexpression lysate

TEN1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn