TA334668 ACADL antibody

Rabbit Polyclonal Anti-ACADL Antibody

See related secondary antibodies

Search for all "ACADL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat ACADL

Product Description for ACADL

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat ACADL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACADL

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms LCAD, Long-chain specific acyl-CoA dehydrogenase, mitochondrial
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ACADL antibody: synthetic peptide directed towards the middle region of human ACADL. Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL.
Application WB
Background ACADL belongs to the acyl-CoA dehydrogese family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogese (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogese family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogese (LCAD) deficiency, leading to nonketotic hypoglycemia.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ACADL (4 products)

Catalog No. Species Pres. Purity   Source  

ACADL (31-430, His-tag)

ACADL Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

ACADL (31-430, His-tag)

ACADL Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH


ACADL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ACADL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn