discontinued

H00006646-D01 ACAT1 / SOAT1 antibody

See related secondary antibodies

Search for all "ACAT1 / SOAT1"

Quick Overview

Rabbit anti Human ACAT1 / SOAT1

Product Description for ACAT1 / SOAT1

Rabbit anti Human ACAT1 / SOAT1.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for ACAT1 / SOAT1

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms ACACT1, Acyl coenzyme A:cholesterol acyltransferase 1, Cholesterol acyltransferase 1, Sterol O-acyltransferase 1
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P35610
Immunogen:
SOAT1 (NP_003092.4, 1 a.a. ~ 550 a.a) full-length human protein.
AA Sequence:
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDF VTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILF ILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFM IFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAP TLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLT FFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVS AVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKN PTFLDYVRPRSWTCRYVF
GeneID:
6646
Remarks:
Gene Accession: NM_003101.4
Add. information Rabbit polyclonal antibody raised against a full-length human SOAT1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 6646

Accessory Products

Proteins and/or Positive Controls

Proteins for ACAT1 / SOAT1 (2 products)

Catalog No. Species Pres. Purity   Source  

ACAT1 / SOAT1

ACAT1 / SOAT1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACAT1 / SOAT1

ACAT1 / SOAT1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ACAT1 / SOAT1 (2 products)

Catalog No. Species Pres. Purity   Source  

SOAT1 293T Cell Transient Overexpression Lysate(Denatured)

SOAT1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SOAT1 overexpression lysate

SOAT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn