
NBP1-54617 ACAT2 antibody

See related secondary antibodies

Search for all "ACAT2"

Quick Overview

Rabbit anti Human ACAT2

Product Description for ACAT2

Rabbit anti Human ACAT2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ACAT2

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ACAT2 (acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)) The peptide sequence was selected from the middle region of ACAT2 . Peptide sequence VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDE
Background Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.

Accessory Products

  • LinkedIn