TA342937 ACBD6 antibody

Rabbit Polyclonal Anti-ACBD6 Antibody

See related secondary antibodies

Search for all "ACBD6"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ACBD6

Product Description for ACBD6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ACBD6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACBD6

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Acyl-CoA-binding domain-containing protein 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-Acbd6 antibody is: synthetic peptide directed towards the middle region of Rat Acbd6. Synthetic peptide located within the following region: SEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHITKAIK.
Application WB
Background Acbd6 binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA, lower affinity for unsaturated C20:4-CoA, and very weak affinity for saturated C16:0-CoA. It Does not bind fatty acids.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 695% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ACBD6 (4 products)

Catalog No. Species Pres. Purity   Source  

ACBD6 (1-282, His-tag)

ACBD6 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ACBD6 (1-282, His-tag)

ACBD6 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH


ACBD6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ACBD6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ACBD6 (1 products)

Catalog No. Species Pres. Purity   Source  

ACBD6 293T Cell Transient Overexpression Lysate(Denatured)

ACBD6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn