TA331464 ACCN5 / HINAC antibody

Rabbit polyclonal Anti-ACCN5 Antibody

See related secondary antibodies

Search for all "ACCN5 / HINAC"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ACCN5 / HINAC

Product Description for ACCN5 / HINAC

Rabbit anti Human ACCN5 / HINAC.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ACCN5 / HINAC

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Amiloride-sensitive cation channel 5
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NY37
Immunogen:
Synthetic peptide directed towards the middle region of human ACCN5
AA Sequence:
FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
GeneID:
51802
Application Western blotting (0.5 - 3 µg/ml)
Background ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
General Readings Schaefer,L., et al., (2000) FEBS Lett. 471 (2-3), 205-210
Storage Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from dispatch.
Format
Purification:
Purified using Protein A affinity column
State:
Lyophilized from PBS
Aff - Purified
Reconstitution:
Add 100 μl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ACCN5 / HINAC (3 products)

Catalog No. Species Pres. Purity   Source  

ACCN5 / HINAC

ACCN5 / HINAC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

ACCN5 / HINAC

ACCN5 / HINAC Human Purified
  Abnova Taiwan Corp.

ACCN5 / HINAC

ACCN5 / HINAC Human Purified
  Abnova Taiwan Corp.

Positive controls for ACCN5 / HINAC (1 products)

Catalog No. Species Pres. Purity   Source  

ASIC5 overexpression lysate

ASIC5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn